ABR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA053618

 

Antibody HPA054824

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA053618 HPA054824 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

70 59 

Antigen sequence

LYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGG
GDGVSPTPPEGLAPGVEAGK
 
EESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKK
MFENEFLLL
 

Matching transcripts

ABR-001 - ENSP00000303909 [100%]
 ABR-001 - ENSP00000303909 [100%]
ABR-002 - ENSP00000461565 [100%]
ABR-003 - ENSP00000291107 [100%]
ABR-004 - ENSP00000442048 [100%]
ABR-024 - ENSP00000458294 [100%]
ABR-026 - ENSP00000437429 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
  

Antibody dilution

1:66  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

97.6 97.6, 93.7, 92.4, 73.5, 21.8 

Antibody dilution

1:330 1:170 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2650 1:1400 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in a dot like pattern in neuronal cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:75 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
ABR-001
 
ABR-002
 
ABR-003
 
ABR-004
 
ABR-024
 
ABR-026