CCDC117

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000826

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000826 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

143 

Antigen sequence

GHGVNPSVSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDE
DEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELV
LWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTEL
 

Matching transcripts

CCDC117-001 - ENSP00000249064 [100%]
CCDC117-203 - ENSP00000389478 [100%]
CCDC117-202 - ENSP00000399363 [84%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human adrenal gland shows strong nuclear positivity in cortical cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:800 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus, cytoplasm & microtubules.
More information
 

Antibody dilution

1:400 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

30.5, 28.3, 16.7 

Antibody dilution

1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CCDC117-001
 
CCDC117-202
 
CCDC117-203