KALRN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011913

 

Antibody CAB026456

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA011913 3636.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

4 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

109  

Antigen sequence

VLQAANADIQQAWVQDINQVLETQRDFLNALQSPIEYQRKERSTAVMRSQ
PARLPQASPRPYSSVPAGSEKPPKGSSYNPPLPPLKISTSNGSPGFEYHQ
PGDKFEASK
 
 

Matching transcripts

KALRN-001 - ENSP00000291478 [100%]
KALRN-002 - ENSP00000377134 [100%]
KALRN-004 - ENSP00000346122 [100%]
KALRN-014 - ENSP00000420318 [100%]
KALRN-201 - ENSP00000353109 [100%]
KALRN-202 - ENSP00000402419 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli.
More information
 

Antibody dilution

1:15 1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Non-supportive: The subcellular location is not consistent with literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

340.3, 336.2, 144.5, 141.2, 82.8, 55.7 340.3, 336.2, 192.2, 191.2, 144.5, 141.2, 82.8, 55.7, 30.5, 24.8, 21.1, 13.6 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
KALRN-001
 
KALRN-002
 
KALRN-004
 
KALRN-014
 
KALRN-201
 
KALRN-202