G6PD

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000247

 

Antibody HPA000834

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000247 HPA000834 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

110 109 

Antigen sequence

EVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEE
SELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTP
LLHQIELEKP
 
FQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGY
ARSRLTVADIRKQSEPFFKATPEEKLKLEDFFARNSYVAGQYDDAASYQR
LNSHMNALH
 

Matching transcripts

G6PD-001 - ENSP00000377192 [100%]
G6PD-006 - ENSP00000377194 [100%]
G6PD-010 - ENSP00000358633 [100%]
 G6PD-001 - ENSP00000377192 [100%]
G6PD-002 - ENSP00000395599 [100%]
G6PD-005 - ENSP00000394690 [100%]
G6PD-006 - ENSP00000377194 [100%]
G6PD-007 - ENSP00000400648 [100%]
G6PD-010 - ENSP00000358633 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bone marrow shows distinct positivity in subsets of hematopoietic cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH9 HIER pH6 

Antibody dilution

1:200 1:4000 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.8, 62.5, 59.3 63.8, 62.5, 59.3, 38.5, 36.5, 29.5 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:1000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
G6PD-001
 
G6PD-002
 
G6PD-005
 
G6PD-006
 
G6PD-007
 
G6PD-010