ADAMTS13

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042014

 

Antibody HPA042844

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042014 HPA042844 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

104 98 

Antigen sequence

CVGADLQAEMCNTQACEKTQLEFMSQQCARTDGQPLRSSPGGASFYHWGA
AVPHSQGDALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLC
VSGS
 
AHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNIT
ANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQV
 

Matching transcripts

ADAMTS13-001 - ENSP00000360997 [100%]
ADAMTS13-002 - ENSP00000347927 [100%]
ADAMTS13-003 - ENSP00000348997 [100%]
ADAMTS13-203 - ENSP00000444504 [100%]
 ADAMTS13-001 - ENSP00000360997 [100%]
ADAMTS13-002 - ENSP00000347927 [100%]
ADAMTS13-003 - ENSP00000348997 [100%]
ADAMTS13-007 - ENSP00000435274 [100%]
ADAMTS13-008 - ENSP00000435305 [100%]
ADAMTS13-201 - ENSP00000360979 [100%]
ADAMTS13-202 - ENSP00000360984 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human liver shows cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:300 1:10 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:172 1:21 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

153.6, 147.8, 144.5, 39.9 153.6, 147.8, 144.5, 36.7, 30.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ADAMTS13-001
 
ADAMTS13-002
 
ADAMTS13-003
 
ADAMTS13-007
 
ADAMTS13-008
 
ADAMTS13-201
 
ADAMTS13-202
 
ADAMTS13-203