DEDD2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043419

 

Antibody HPA043554

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043419 HPA043554 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

55 54 

Antigen sequence

VRAEYCEHGPALEQGVASRRPQALARQLDVFGQATAVLRSRDLGSVVCDI
KFSEL
 
DYLSGALLQALRGVFLTEALREAVGREAVRLLVSVDEADYEAGRRRLLLM
EEEG
 

Matching transcripts

DEDD2-001 - ENSP00000470082 [100%]
DEDD2-003 - ENSP00000471512 [100%]
DEDD2-011 - ENSP00000336972 [100%]
 DEDD2-001 - ENSP00000470082 [100%]
DEDD2-003 - ENSP00000471512 [100%]
DEDD2-011 - ENSP00000336972 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows moderate membranous and cytoplasmic positivity in renal tubules.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:35 1:800 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408867)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

36.2, 35.6 36.2, 35.6 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
DEDD2-001
 
DEDD2-003
 
DEDD2-011