ADAR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003890

 

Antibody HPA051519

 

Antibody CAB056157

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
 

Product name

HPA003890 HPA051519 AMAb90535 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 13 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

139 142  

Antigen sequence

SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHG
FAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAAL
RVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA
 
ALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFI
VNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPR
NELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDY
 
 

Matching transcripts

ADAR-001 - ENSP00000357459 [100%]
ADAR-002 - ENSP00000357456 [100%]
ADAR-201 - ENSP00000292205 [100%]
ADAR-007 - ENSP00000431794 [88%]
 ADAR-001 - ENSP00000357459 [100%]
ADAR-002 - ENSP00000357456 [100%]
ADAR-007 - ENSP00000431794 [100%]
ADAR-201 - ENSP00000292205 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and subset of glial cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
More information
 Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:800 1:1200 1:1000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:87 1:135  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         siRNA

Image

   

Description

Signal downregulation > 25% by both siRNA:s.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:88   

Validation siRNA

Supportive: The siRNA validation is supportive.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

140.8, 136.1, 132.6, 103.6 140.8, 136.1, 132.6, 103.6 140.8, 136.1, 132.6, 103.6 

Antibody dilution

1:250 1:670 1:1000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:5400  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ADAR-001
 
ADAR-002
 
ADAR-007
 
ADAR-201