ADAR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003890

 

Antibody CAB056157

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
 

Product name

HPA003890 AMAb90535 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

139  

Antigen sequence

SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHG
FAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAAL
RVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA
 
 

Matching transcripts

ADAR-001 - ENSP00000357459 [100%]
ADAR-002 - ENSP00000357456 [100%]
ADAR-201 - ENSP00000292205 [100%]
ADAR-007 - ENSP00000431794 [88%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
More information
 Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:600 1:1000 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

140.8, 136.1, 132.6, 103.6 140.8, 136.1, 132.6, 103.6 

Antibody dilution

1:250 1:1000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
ADAR-001
 
ADAR-002
 
ADAR-007
 
ADAR-201