CCDC12

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049307

 

Antibody HPA056814

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA049307 HPA056814 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

72 81 

Antigen sequence

KPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERL
KGQEDSLASAVDAATEQKTCDS
 
EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYV
PEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK
 

Matching transcripts

CCDC12-001 - ENSP00000416263 [100%]
CCDC12-201 - ENSP00000292314 [100%]
CCDC12-202 - ENSP00000441327 [100%]
 CCDC12-001 - ENSP00000416263 [100%]
CCDC12-201 - ENSP00000292314 [100%]
CCDC12-202 - ENSP00000441327 [100%]
CCDC12-006 - ENSP00000387490 [94%]
CCDC12-011 - ENSP00000473887 [84%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, cytoplasm & cytoskeleton (cytokinetic bridge).
More information
  

Antibody dilution

1:48  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

20.5, 19.2 20.5, 19.2, 11.9, 10.9 

Antibody dilution

1:240 1:420 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1900 1:5050 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human stomach, lower shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:150 

Validation IH

 Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
CCDC12-001
 
CCDC12-006
 
CCDC12-011
 
CCDC12-201
 
CCDC12-202