PTH1R

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007978

 

Antibody CAB016053

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA007978 sc-12722 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

111  

Antigen sequence

RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPT
ATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEA
SGPERPPALLQ
 
 

Matching transcripts

PTH1R-001 - ENSP00000321999 [100%]
PTH1R-002 - ENSP00000402723 [100%]
PTH1R-003 - ENSP00000411424 [100%]
PTH1R-008 - ENSP00000396176 [100%]
PTH1R-201 - ENSP00000413774 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows moderate positivity in a subset of tubules.
More information
 Immunohistochemical staining of human kidney shows positivity tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:40 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

66.4, 20.0 66.4, 59.5, 37.6, 20.0 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PTH1R-001
 
PTH1R-002
 
PTH1R-003
 
PTH1R-008
 
PTH1R-201