PPP1R35

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051607

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051607 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

78 

Antigen sequence

NAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDG
LPPLRLQLRPRPSEDTFLMHRTLRRWEA
 

Matching transcripts

PPP1R35-001 - ENSP00000292330 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:120 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

 

Target mass (kDa)

28.0 

Antibody dilution

1:100 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:900 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PPP1R35-001