FDXR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044393

 

Antibody HPA053673

 

Antibody CAB009818

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA044393 HPA053673 sc-25846 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

134 93  

Antigen sequence

MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAG
FYTAQHLLKHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTA
HSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYG
 
PFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQML
LQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAE
 
 

Matching transcripts

FDXR-001 - ENSP00000293195 [99%]
FDXR-003 - ENSP00000463940 [99%]
FDXR-018 - ENSP00000462972 [99%]
FDXR-006 - ENSP00000462183 [93%]
 FDXR-001 - ENSP00000293195 [100%]
FDXR-002 - ENSP00000416515 [100%]
FDXR-003 - ENSP00000463940 [100%]
FDXR-006 - ENSP00000462183 [100%]
FDXR-008 - ENSP00000408595 [100%]
FDXR-009 - ENSP00000414172 [100%]
FDXR-011 - ENSP00000445432 [100%]
FDXR-018 - ENSP00000462972 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human ovary shows strong cytoplasmic positivity in follicle cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells with often granular pattern.
More information
 Immunohistochemical staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:60 1:1600 1:900 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.4, 53.8, 52.9, 50.6 58.2, 57.3, 54.4, 53.8, 52.9, 50.6, 49.4, 48.0 58.2, 57.3, 54.4, 53.8, 52.9, 50.6, 49.4, 48.0, 19.5, 18.0 

Antibody dilution

1:250 1:1760 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:14050  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FDXR-001
 
FDXR-002
 
FDXR-003
 
FDXR-006
 
FDXR-008
 
FDXR-009
 
FDXR-011
 
FDXR-018