FDXR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044393

 

Antibody CAB008597

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 AbFrontier
 

Product name

HPA044393 LF-MA0033 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Ammonium Sulfate Precipitation 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

134  

Antigen sequence

MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAG
FYTAQHLLKHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTA
HSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYG
 
 

Matching transcripts

FDXR-001 - ENSP00000293195 [100%]
FDXR-018 - ENSP00000462972 [100%]
FDXR-003 - ENSP00000463940 [99%]
FDXR-006 - ENSP00000462183 [94%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells and glial cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:100 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.5, 53.8, 52.9, 50.6 58.3, 57.4, 54.5, 53.8, 52.9, 50.6, 49.4, 48.1, 41.6, 19.6, 18.1, 9.9, 8.4, 5.0, 4.9 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
  

Antibody dilution

1:45  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
FDXR-001
 
FDXR-003
 
FDXR-006
 
FDXR-018