SAP30BP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042382

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042382 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

110 

Antigen sequence

SEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTT
TASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGS
KTTVISAVGT
 

Matching transcripts

SAP30BP-001 - ENSP00000462116 [100%]
SAP30BP-002 - ENSP00000347592 [100%]
SAP30BP-015 - ENSP00000463758 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic with additional nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:75 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415705)
More information
 

Target mass (kDa)

35.8, 33.9, 32.1 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SAP30BP-001
 
SAP30BP-002
 
SAP30BP-015