ALOX15

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA013859

 

Antibody CAB004962

 

Antibody CAB004963

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Karolinska Institute
 Karolinska Institute
 

Product name

HPA013859 n/a  

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb msAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Not known 

Released in version

4 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Synthetic peptide 

Length (aa)

118   

Antigen sequence

RTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVD
ERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSK
LAERVRDSWKEDALFGYQ
 
 
 

Matching transcripts

ALOX15-001 - ENSP00000458832 [100%]
ALOX15-002 - ENSP00000460483 [100%]
ALOX15-201 - ENSP00000293761 [100%]
ALOX15-202 - ENSP00000439855 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows distinct membranous positivity in cells in glomeruli.
More information
 Immunohistochemical staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:700 1:500 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400456)
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

77.5, 74.8, 70.1 77.5, 74.8, 70.1, 12.3, 0.3 77.5, 74.8, 70.1, 12.3, 0.3 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
ALOX15-001
 
ALOX15-002
 
ALOX15-201
 
ALOX15-202