SNX7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037419

 

Antibody HPA054338

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA037419 HPA054338 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

87 75 

Antigen sequence

IADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMR
GVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEE
 
IHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVL
YSEMLMGVMKRRDQIQAELDSKVEV
 

Matching transcripts

SNX7-001 - ENSP00000304429 [100%]
SNX7-201 - ENSP00000359208 [100%]
 SNX7-001 - ENSP00000304429 [100%]
SNX7-005 - ENSP00000434731 [100%]
SNX7-201 - ENSP00000359208 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells in granular pattern.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:125  

Literature conformity

Partly consistent with gene/protein characterization data  

RNA consistency

Not done  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407673)
More information
  

Target mass (kDa)

51.6, 39.2 51.6, 45.0, 39.2 

Antibody dilution

1:125 1:1200 

Validation WB

Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:9650 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli & cytoplasm.
More information
 

Antibody dilution

 1:200 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
SNX7-001
 
SNX7-005
 
SNX7-201