AGL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028498

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA028498 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

100 

Antigen sequence

EVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLD
NCHSTPLHVAEYMLDAARNLQPNLYVVAELFTGSEDLDNVFVTRLGISSL
 

Matching transcripts

AGL-001 - ENSP00000355106 [100%]
AGL-002 - ENSP00000359184 [100%]
AGL-003 - ENSP00000359182 [100%]
AGL-004 - ENSP00000294724 [100%]
AGL-005 - ENSP00000354971 [100%]
AGL-006 - ENSP00000354635 [100%]
AGL-201 - ENSP00000359180 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows strong granular positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:60 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 

Antibody dilution

1:50 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

174.8, 172.7, 172.6 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
AGL-001
 
AGL-002
 
AGL-003
 
AGL-004
 
AGL-005
 
AGL-006
 
AGL-201