MAPKAPK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045556

 

Antibody CAB010297

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA045556 sc-7871 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

37  

Antigen sequence

TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL
 
 

Matching transcripts

MAPKAPK2-001 - ENSP00000356070 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human gall bladder shows distinct cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:60 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

45.6 45.6, 42.2 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli & centrosome.
More information
  

Antibody dilution

1:21  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MAPKAPK2-001