ARL5A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027002

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA027002 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

100 

Antigen sequence

QESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAG
LLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGL
 

Matching transcripts

ARL5A-001 - ENSP00000295087 [100%]
ARL5A-002 - ENSP00000415950 [100%]
ARL5A-004 - ENSP00000394626 [100%]
 

Other gene match

ARL5B - ENSG00000165997 [80%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:15 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

20.7, 20.4, 16.4 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARL5A-001
 
ARL5A-002
 
ARL5A-004