FZD5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052361

 

Antibody HPA053811

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA052361 HPA053811 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

44 52 

Antigen sequence

WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP
 
GPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFA
TF
 

Matching transcripts

FZD5-001 - ENSP00000354607 [100%]
 FZD5-001 - ENSP00000354607 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lateral ventricle shows moderate positivity in neurons.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:225 1:425 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

64.5 64.5 

Antibody dilution

1:800 1:380 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6350 1:3100 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FZD5-001