GPR155

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036159

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036159 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

74 

Antigen sequence

HLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRN
IVKERRCGAKTSAGTFCGCDLVSW
 

Matching transcripts

GPR155-001 - ENSP00000376335 [100%]
GPR155-002 - ENSP00000295500 [100%]
GPR155-003 - ENSP00000376334 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

96.9 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GPR155-001
 
GPR155-002
 
GPR155-003