HIPK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA016664

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA016664 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

137 

Antigen sequence

MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLP
ATQGQANSSHQVANFNIPAYDQGLLLPAPAVEHIVVTAADSSGSAATSTF
QSSQTLTHRSNVSLLEPYQKCGLKRKSEEVDSNGSVQ
 

Matching transcripts

HIPK1-001 - ENSP00000358571 [100%]
HIPK1-002 - ENSP00000358572 [100%]
HIPK1-004 - ENSP00000358568 [100%]
HIPK1-006 - ENSP00000407442 [100%]
HIPK1-009 - ENSP00000358574 [100%]
HIPK1-201 - ENSP00000358567 [100%]
HIPK1-010 - ENSP00000422322 [87%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

1:11 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

130.8, 127.1, 126.3, 116.7, 12.6 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HIPK1-001
 
HIPK1-002
 
HIPK1-004
 
HIPK1-006
 
HIPK1-009
 
HIPK1-010
 
HIPK1-201