SMIM14

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051299

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051299 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

38 

Antigen sequence

AEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECL
 

Matching transcripts

SMIM14-001 - ENSP00000295958 [100%]
SMIM14-002 - ENSP00000422904 [100%]
SMIM14-004 - ENSP00000421087 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:15 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line PC-3 shows positivity in mitochondria.
More information
 

Antibody dilution

1:31 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

10.7, 9.7, 6.1 

Antibody dilution

1:160 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1250 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SMIM14-001
 
SMIM14-002
 
SMIM14-004