PRKCD

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001863

 

Antibody HPA001890

 

Antibody CAB010469

 

Antibody CAB013225

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Zymed
 

Product name

HPA001863 HPA001890 sc-937 41-0300 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity Not known 

Released in version

2 2 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide Not known 

Length (aa)

143 146   

Antigen sequence

AFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKS
TFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLD
LQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQ
 
ANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGED
MQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFA
IKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDH
 
 
 

Matching transcripts

PRKCD-001 - ENSP00000378217 [100%]
PRKCD-002 - ENSP00000331602 [100%]
PRKCD-006 - ENSP00000419629 [100%]
PRKCD-005 - ENSP00000418106 [83%]
 PRKCD-001 - ENSP00000378217 [100%]
PRKCD-002 - ENSP00000331602 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.
More information
 Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in ,reaction center cells.
More information
 Immunohistochemical staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:10 1:100 1:1500 1:1000 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403724)
More information
 Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

77.5, 25.5, 14.2 77.5 77.5, 25.5, 14.2, 8.8 77.5, 25.5, 14.2, 8.8 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:500 1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   

         Immunofluorescence

Image

    

Description

  Immunofluorescent staining of human cell line U-251 MG shows positivity in Golgi apparatus & nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

  1:200  

Validation IF

  Uncertain: The subcellular location is partly supported by literature or no literature is available.  
 

ANTIGEN VIEW

? »
 
 
 
PRKCD-001
 
PRKCD-002
 
PRKCD-005
 
PRKCD-006