CAMP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029874

 

Antibody CAB015949

 

Antibody CAB016522

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Karolinska Institute MBB
 Karolinska Institute MBB
 

Product name

HPA029874   

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Not known 

Released in version

6 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Synthetic peptide 

Length (aa)

119   

Antigen sequence

RSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCD
FKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGK
EFKRIVQRIKDFLRNLVPR
 
 
 

Matching transcripts

CAMP-001 - ENSP00000296435 [100%]
CAMP-201 - ENSP00000458149 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subsets of bone marrow poietic cells.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:5000 1:1900 1:1500 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

19.6, 19.3 19.6, 19.3 19.6, 19.3 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CAMP-001
 
CAMP-201