CAMKV

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007656

 

Antibody CAB034931

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA007656 sc-102406 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

101  

Antigen sequence

LLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDL
VTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGVCAQIEKNFARAK
W
 
 

Matching transcripts

CAMKV-001 - ENSP00000419195 [100%]
CAMKV-006 - ENSP00000417614 [100%]
CAMKV-007 - ENSP00000418809 [100%]
CAMKV-008 - ENSP00000420724 [100%]
CAMKV-010 - ENSP00000420053 [100%]
CAMKV-005 - ENSP00000296471 [97%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human hippocampus shows moderate nuceolar positivity in neuronal cells, subset of glial cells showed strong cytoplasmic staining.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:250 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.4, 51.7, 51.2, 49.6, 46.7, 45.7 54.4, 51.7, 51.2, 49.6, 46.7, 45.7, 16.7, 14.0, 10.2 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CAMKV-001
 
CAMKV-005
 
CAMKV-006
 
CAMKV-007
 
CAMKV-008
 
CAMKV-010