ANXA5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035330

 

Antibody CAB003677

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abnova
 

Product name

HPA035330 H00000308-M01 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

111  

Antigen sequence

LVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRS
VSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLA
ETLYYAMKGAG
 
 

Matching transcripts

ANXA5-001 - ENSP00000296511 [100%]
ANXA5-003 - ENSP00000424106 [100%]
ANXA5-004 - ENSP00000424199 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:1500 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

35.9, 29.3, 24.7 35.9, 29.3, 24.7, 18.2, 3.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line PC-3 shows positivity in nuclear membrane.
More information
  

Antibody dilution

1:43  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ANXA5-001
 
ANXA5-003
 
ANXA5-004