CASP3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002643

 

Antibody CAB000091

 

Antibody CAB008381

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 MBL
 

Product name

HPA002643 AF835 M087-3 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Not known 

Released in version

4 1 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Recombinant protein 

Length (aa)

115   

Antigen sequence

HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDA
ANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSH
GEEGIIFGTNGPVDL
 
 
 

Matching transcripts

CASP3-001 - ENSP00000311032 [100%]
CASP3-002 - ENSP00000377210 [100%]
CASP3-003 - ENSP00000428929 [100%]
CASP3-005 - ENSP00000377213 [100%]
CASP3-006 - ENSP00000428372 [100%]
CASP3-004 - ENSP00000407142 [83%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in granular pattern in cortical cells.
More information
 Immunohistochemical staining of human lymph node shows strong positivity in subsets of cells outside the reaction center.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:750 1:4000 1:500 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Liver
Lane 5: Tonsil
Lane 6:
More information
  Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

31.6, 20.5, 13.4 31.6, 20.5, 13.4 31.6, 20.5, 13.4 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in mitochondria & nucleus but excluded from the nucleoli.
More information
   

Antibody dilution

1:83   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CASP3-001
 
CASP3-002
 
CASP3-003
 
CASP3-004
 
CASP3-005
 
CASP3-006