FZD6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017991

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA017991 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

133 

Antigen sequence

TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPR
LREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDIT
DTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS
 

Matching transcripts

FZD6-001 - ENSP00000429055 [100%]
FZD6-002 - ENSP00000429528 [100%]
FZD6-201 - ENSP00000351605 [100%]
FZD6-202 - ENSP00000443757 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human urinary bladder shows strong positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:125 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane.
More information
 

Antibody dilution

1:154 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401182)
More information
 

Target mass (kDa)

79.3, 75.6, 44.3 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FZD6-001
 
FZD6-002
 
FZD6-201
 
FZD6-202