SYK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001384

 

Antibody CAB007773

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA001384 1688-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

3 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

133  

Antigen sequence

GLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFP
KPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYE
SPYADPEEIRPKEVYLDRKLLTLEDKELGSGNF
 
 

Matching transcripts

SYK-001 - ENSP00000364907 [100%]
SYK-002 - ENSP00000364898 [100%]
SYK-003 - ENSP00000364899 [83%]
SYK-004 - ENSP00000364904 [83%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.
More information
 Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and cells outside reaction centra.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

72.1, 69.5 72.1, 69.5 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SYK-001
 
SYK-002
 
SYK-003
 
SYK-004