TRPV6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA062864

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA062864 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

51 

Antigen sequence

SPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEY
Q
 

Matching transcripts

TRPV6-001 - ENSP00000352358 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts of testis while Leydig cells shows moderate cytoplasmic positivity .
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

83.2 

Antibody dilution

1:380 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:4600 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TRPV6-001