CXorf58

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031542

 

Antibody HPA031543

 

Antibody HPA031544

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA031542 HPA031543 HPA031544 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 6 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

78 88 75 

Antigen sequence

LRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLA
KEKNTSEVTEPKTGPSGTKDNYHLHSIF
 
THEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHG
YKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDER
 
FPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRT
MLMYDIVHYSESGVISNRLRNEMKF
 

Matching transcripts

CXorf58-001 - ENSP00000368511 [100%]
 CXorf58-001 - ENSP00000368511 [100%]
 CXorf58-001 - ENSP00000368511 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in testis.
More information
 Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in testis.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:8 1:75 1:150 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

38.9 38.9 38.9 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CXorf58-001