CLDN2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030737

 

Antibody HPA051548

 

Antibody CAB002609

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA030737 HPA051548 RB-9260 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

31 40  

Antigen sequence

LWMECATHSTGITQCDIYSTLLGLPADIQAA
 
RSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
 
 

Matching transcripts

CLDN2-001 - ENSP00000336571 [100%]
CLDN2-201 - ENSP00000443230 [100%]
CLDN2-202 - ENSP00000441283 [100%]
 CLDN2-001 - ENSP00000336571 [100%]
CLDN2-201 - ENSP00000443230 [100%]
CLDN2-202 - ENSP00000441283 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:400 

Validation IH

  Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

24.5 24.5 24.5 

Antibody dilution

1:250 1:330 1:500 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line CACO-2 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line CACO-2 shows positivity in cell junctions & nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:42 1:66  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:2650  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CLDN2-001
 
CLDN2-201
 
CLDN2-202