CDX2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045669

 

Antibody HPA049580

 

Antibody CAB002221

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA045669 HPA049580 NCL-CDX2 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

46 41  

Antigen sequence

MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVA
 
PGPLRSVPEPLSPVSSLQASVPGSVPGVLGPTGGVLNPTVT
 
 

Matching transcripts

CDX2-001 - ENSP00000370408 [100%]
 CDX2-001 - ENSP00000370408 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:50 

Validation IH

  Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

33.5 33.5 33.5 

Antibody dilution

1:250 1:140 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line CACO-2 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line CACO-2 shows positivity in nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:28 1:28  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:1100  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CDX2-001