RET

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008356

 

Antibody CAB002581

 

Antibody CAB018342

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 Santa Cruz Biotechnology
 

Product name

HPA008356 NCL-RET sc-167 

Host species

Rabbit Mouse Rabbit 

Clonality

pAb mAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Affinity 

Released in version

4 1 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Synthetic peptide 

Length (aa)

147   

Antigen sequence

NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAG
YTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLL
LIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
 
 
 

Matching transcripts

RET-001 - ENSP00000347942 [100%]
RET-002 - ENSP00000344798 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human adrenal gland shows cytoplasmic membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human adrenal gland shows cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:60 1:45 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

124.3, 119.8 124.3, 119.8, 19.4 124.3, 119.8, 19.4 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
RET-001
 
RET-002