PACSIN3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039480

 

Antibody HPA043904

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039480 HPA043904 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

59 75 

Antigen sequence

EWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGTGQD
EEWSDEESP
 
KPWLKRLKEVEASKKSYHAARKDEKTAQTRESHAKADSAVSQEQLRKLQE
RVERCAKEAEKTKAQYEQTLAELHR
 

Matching transcripts

PACSIN3-002 - ENSP00000298838 [100%]
PACSIN3-003 - ENSP00000437252 [100%]
PACSIN3-201 - ENSP00000440945 [100%]
PACSIN3-010 - ENSP00000433962 [81%]
 PACSIN3-001 - ENSP00000431948 [100%]
PACSIN3-002 - ENSP00000298838 [100%]
PACSIN3-003 - ENSP00000437252 [100%]
PACSIN3-201 - ENSP00000440945 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:400 1:1200 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:154 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

48.5, 46.5, 8.2 48.5, 46.5, 37.2 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:30000 1:12000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PACSIN3-001
 
PACSIN3-002
 
PACSIN3-003
 
PACSIN3-010
 
PACSIN3-201