CKB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001254

 

Antibody CAB047313

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 NCI-CPTC
 

Product name

HPA001254 CPTC-CKB-2 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

1 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

145  

Antigen sequence

VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSN
LGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDV
SNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
 
 

Matching transcripts

CKB-001 - ENSP00000299198 [100%]
CKB-018 - ENSP00000451426 [92%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in a subset of glial cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes and neuropil.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:6000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.6, 20.1 42.6, 24.1, 20.1, 14.2, 9.7, 6.6, 2.0 

Antibody dilution

1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CKB-001
 
CKB-018