CKB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001254

 

Antibody CAB047313

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 NCI-CPTC
 

Product name

HPA001254 CPTC-CKB-2 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

1 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

145  

Antigen sequence

VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSN
LGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDV
SNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
 
 

Matching transcripts

CKB-001 - ENSP00000299198 [100%]
CKB-018 - ENSP00000451426 [92%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in a subset of glial cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes and neuropil.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:6000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.6, 20.1 42.6, 24.1, 20.1, 14.2, 9.7, 6.6, 2.0 

Antibody dilution

1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CKB-001
 
CKB-018