CCDC182

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023446

 

Antibody HPA023454

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA023446 HPA023454 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

77 73 

Antigen sequence

EDAFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLR
EHCKRLEDLLLDRGRDALRATKKSQAD
 
LYQAGSILMTVNTLQGKKMIESGLQSGDFSLSQSWPSCLPPPADLEILQQ
KVAGVQRELEDFKKEALKSIHYL
 

Matching transcripts

CCDC182-001 - ENSP00000299415 [100%]
 CCDC182-001 - ENSP00000299415 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows nuclear positivity in cells of seminiferous ducts.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:300  

Literature conformity

No avaliable gene/protein characterization data  

RNA consistency

Not consistent with RNA expression data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in the Golgi apparatus.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 

Antibody dilution

1:200 1:200 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

17.5 17.5 

Antibody dilution

1:250 1:250 

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CCDC182-001