ILK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048437

 

Antibody CAB004041

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Cell Signaling Technology, Inc
 

Product name

HPA048437 3862 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

124  

Antigen sequence

DLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDT
FWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDI
VVKVLKVRDWSTRKSRDFNEECPR
 
 

Matching transcripts

ILK-001 - ENSP00000299421 [100%]
ILK-002 - ENSP00000403487 [100%]
ILK-003 - ENSP00000379975 [100%]
ILK-201 - ENSP00000439606 [86%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:50 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Testis
More information
 

Target mass (kDa)

51.4, 36.5 51.4, 44.3, 36.5, 24.4, 23.1, 4.6, 4.1 

Antibody dilution

1:350 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm, cell junctions & nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:69  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2800  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ILK-001
 
ILK-002
 
ILK-003
 
ILK-201