IDH3A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041465

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041465 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

59 

Antigen sequence

PTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSD
FTEEICRRV
 

Matching transcripts

IDH3A-001 - ENSP00000299518 [100%]
IDH3A-006 - ENSP00000453084 [100%]
IDH3A-017 - ENSP00000453989 [100%]
IDH3A-201 - ENSP00000387506 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:225 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in mitochondria.
More information
 

Antibody dilution

1:52 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

39.6, 35.8, 28.1, 9.3 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
IDH3A-001
 
IDH3A-006
 
IDH3A-017
 
IDH3A-201