AP1G1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041224

 

Antibody CAB009049

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA041224 sc-10763 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

93  

Antigen sequence

FLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITI
QASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTI
 
 

Matching transcripts

AP1G1-001 - ENSP00000299980 [100%]
AP1G1-002 - ENSP00000454523 [100%]
AP1G1-008 - ENSP00000454219 [100%]
AP1G1-014 - ENSP00000377148 [100%]
AP1G1-201 - ENSP00000409153 [100%]
AP1G1-202 - ENSP00000403259 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:25 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

94.1, 91.7, 91.4, 26.3 94.1, 91.7, 91.4, 27.1, 26.3, 23.9, 21.4, 20.1, 16.6, 16.0, 10.8, 10.0, 6.3, 3.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
  

Antibody dilution

1:28  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AP1G1-001
 
AP1G1-002
 
AP1G1-008
 
AP1G1-014
 
AP1G1-201
 
AP1G1-202