GOLGA6C

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044978

 

Antibody HPA045056

 

Antibody HPA050087

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044978 HPA045056 HPA050087 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 9 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

34 46 36 

Antigen sequence

GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA
 
EHQLEEAKKTNNEIHKAQMERLETINILTLEKADLKTTLYHTKRAA
 
ALCAVSTQQQEEDRSSSCREAVLHRRLQQTIKERAL
 

Matching transcripts

GOLGA6C-001 - ENSP00000300576 [100%]
 GOLGA6C-001 - ENSP00000300576 [98%]
 GOLGA6C-001 - ENSP00000300576 [94%]
 

Other gene match

GOLGA6D - ENSG00000140478 [100%]
GOLGA6A - ENSG00000159289 [100%]
GOLGA6B - ENSG00000215186 [100%]
 GOLGA6D - ENSG00000140478 [98%]
GOLGA6A - ENSG00000159289 [100%]
GOLGA6B - ENSG00000215186 [100%]
 GOLGA6D - ENSG00000140478 [97%]
GOLGA6A - ENSG00000159289 [94%]
GOLGA6B - ENSG00000215186 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
  Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in spermatids.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:225  1:10 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara  Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
  

Antibody dilution

1:189 1:24  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

79.9 79.9 79.9 

Antibody dilution

1:250 1:250 1:80 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:3000 1:550 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GOLGA6C-001