ANKRD11

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041593

 

Antibody HPA049470

 

Antibody CAB019288

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA041593 HPA049470 2788.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

97 94  

Antigen sequence

LSCPSYEEVMHTPRTPSCSADDYADLVFDCADSQHSTPVPTAPTSACSPS
FFDRFSVASSGLSENASQAPARPLSTNLYRSVSVDIRRTPEEEFSVG
 
NKEKGQCSISQELKLKSFTYEYEDSKQKSDKAILLENDLSTENKLKVLKH
DRDHFKKEEKLSKMKLEEKEWLFKDEKSLKRIKDTNKDISRSFR
 
 

Matching transcripts

ANKRD11-001 - ENSP00000301030 [100%]
ANKRD11-014 - ENSP00000367581 [100%]
 ANKRD11-001 - ENSP00000301030 [100%]
ANKRD11-014 - ENSP00000367581 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human rectum shows strong nuclear and a weaker cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:200 

Validation IH

  Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 

Antibody dilution

1:93 1:152 1:50 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Target too small/large to be analyzed with the present setup Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

297.9 297.9 297.9, 23.3, 13.4, 10.5, 3.8 

Antibody dilution

 1:760 1:500 

Validation WB

 Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:6050  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ANKRD11-001
 
ANKRD11-014