GLOD4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021623

 

Antibody HPA023246

 

Antibody HPA023248

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA021623 HPA023246 HPA023248 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

78 70 72 

Antigen sequence

ENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPE
GSKLLDDAMAADKSDEWFAKHNKPKASG
 
KSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAF
GRIAFSCPQKELPDLEDLMK
 
ELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEA
PGGYKFYLQNRSLPQSDPVLKV
 

Matching transcripts

GLOD4-001 - ENSP00000301329 [100%]
GLOD4-005 - ENSP00000301328 [100%]
GLOD4-007 - ENSP00000458849 [100%]
GLOD4-201 - ENSP00000444315 [100%]
 GLOD4-001 - ENSP00000301329 [100%]
GLOD4-005 - ENSP00000301328 [100%]
GLOD4-201 - ENSP00000444315 [100%]
GLOD4-008 - ENSP00000460634 [87%]
 GLOD4-001 - ENSP00000301329 [100%]
GLOD4-005 - ENSP00000301328 [100%]
GLOD4-008 - ENSP00000460634 [100%]
GLOD4-201 - ENSP00000444315 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human duodenum shows distinct positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:45 1:400 1:300 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus, nucleoli & cytoplasm.
More information
 

Antibody dilution

1:20 1:100 1:100 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

34.8, 33.2, 32.0, 12.7 34.8, 33.2, 32.0, 25.5 34.8, 33.2, 32.0, 25.5 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
GLOD4-001
 
GLOD4-005
 
GLOD4-007
 
GLOD4-008
 
GLOD4-201