ITFG3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011747

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA011747 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

104 

Antigen sequence

SSPCTFAAAVSGANGSTLWERPVAQDVALVECAVPQPRGSEAPSACILVG
RPSSFIAVNLFTGETLWNHSSSFSGNASILSPLLQVPDVDGDGAPDLLVL
TQER
 

Matching transcripts

ITFG3-001 - ENSP00000382814 [100%]
ITFG3-002 - ENSP00000301679 [100%]
ITFG3-003 - ENSP00000301678 [100%]
ITFG3-004 - ENSP00000399150 [100%]
ITFG3-201 - ENSP00000397477 [100%]
ITFG3-202 - ENSP00000411394 [100%]
ITFG3-009 - ENSP00000398433 [99%]
ITFG3-010 - ENSP00000407669 [95%]
 

Other gene match

ITFG3 - ENSG00000269881 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in a few glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:200 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410348)
More information
 

Target mass (kDa)

59.7, 58.4, 57.5, 26.5, 25.8, 25.4 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ITFG3-001
 
ITFG3-002
 
ITFG3-003
 
ITFG3-004
 
ITFG3-009
 
ITFG3-010
 
ITFG3-201
 
ITFG3-202