CASKIN1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA055990

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA055990 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

51 

Antigen sequence

GKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFS
A
 

Matching transcripts

CASKIN1-001 - ENSP00000345436 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in subset of neuronal cells and neuropil.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:700 

Literature conformity

No avaliable gene/protein characterization data 

RNA consistency

Consistent with RNA expression data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus.
More information
 

Antibody dilution

1:110 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

149.8 

Antibody dilution

1:550 

Validation WB

Current setup is not applicable due to low RNA count 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:4400 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CASKIN1-001