SLC3A2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017980

 

Antibody CAB010455

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA017980 sc-9160 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

141  

Antigen sequence

KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLL
QSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDG
FQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL
 
 

Matching transcripts

SLC3A2-001 - ENSP00000367122 [100%]
SLC3A2-002 - ENSP00000367121 [100%]
SLC3A2-003 - ENSP00000367123 [100%]
SLC3A2-004 - ENSP00000340815 [100%]
SLC3A2-026 - ENSP00000444236 [100%]
SLC3A2-201 - ENSP00000367124 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong membranous positivity in tubular cells.
More information
 Immunohistochemical staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:4500 1:300 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus, plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoskeleton (actin filaments).
More information
 

Antibody dilution

1:222 1:286 

Validation IF

Supportive: The subcellular location is supported by literature. Non-supportive: The subcellular location is not consistent with literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400390)
More information
  

Target mass (kDa)

71.1, 68.1, 68.0, 64.9, 61.8, 57.9 71.1, 68.1, 68.0, 64.9, 61.8, 57.9, 26.0, 19.0, 15.8, 14.8, 13.2, 7.0, 5.3, 2.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:30000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SLC3A2-001
 
SLC3A2-002
 
SLC3A2-003
 
SLC3A2-004
 
SLC3A2-026
 
SLC3A2-201