CX3CR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046587

 

Antibody CAB032478

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA046587 sc-20432 

Host species

Rabbit Goat 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

61  

Antigen sequence

LEAFKLADLDFRKSSLASGWRMASGAFTMDQFPESVTENFEYDDLAEACY
IGDIVVFGTVF
 
 

Matching transcripts

CX3CR1-201 - ENSP00000351059 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lateral ventricle shows distinct positivity.
More information
 Immunohistochemical staining of human tonsil shows strong positivity in a subsets of cells outside reaction centra.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:25 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly not consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

44.0 44.0, 40.4, 18.4, 11.9 

Antibody dilution

1:160 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1300  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CX3CR1-201