BMP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014572

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA014572 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

110 

Antigen sequence

DSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKA
AVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIP
FVIGGNFTGS
 

Matching transcripts

BMP1-001 - ENSP00000305714 [100%]
BMP1-002 - ENSP00000428249 [100%]
BMP1-003 - ENSP00000428665 [100%]
BMP1-004 - ENSP00000430977 [100%]
BMP1-005 - ENSP00000428798 [100%]
BMP1-007 - ENSP00000430406 [100%]
BMP1-009 - ENSP00000428332 [100%]
BMP1-010 - ENSP00000306121 [100%]
BMP1-015 - ENSP00000427950 [100%]
BMP1-201 - ENSP00000346941 [100%]
BMP1-202 - ENSP00000380915 [100%]
BMP1-203 - ENSP00000380917 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

111.2, 92.7, 82.9, 81.1, 70.5, 33.4, 21.0 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
BMP1-001
 
BMP1-002
 
BMP1-003
 
BMP1-004
 
BMP1-005
 
BMP1-007
 
BMP1-009
 
BMP1-010
 
BMP1-015
 
BMP1-201
 
BMP1-202
 
BMP1-203
 
 »